SCOP 1.63: Domain d1mwad1: 1mwa D:1-117

Lineage for d1mwad1 (1mwa D:1-117)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (15 PDB entries)

8. Domain d1mwad1: 1mwa D:1-117 [79564]
   Other proteins in same PDB: d1mwaa2, d1mwab2, d1mwac2, d1mwad2, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_
   complexed with acy, gol, man, nag

Details for d1mwad1

PDB Entry: 1mwa, 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex

SCOP Domain Sequences for d1mwad1:

Sequence; same for both SEQRES and ATOM records:

>d1mwad1 b.1.1.1 (D:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle

Timeline for d1mwad1:

• d1mwad1 is new in SCOP 1.63
  
• d1mwad1 appears in SCOP 1.65
  
• d1mwad1 appears in the current release, SCOPe 2.08