Lineage for d1mwac2 (1mwa C:118-213)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 290095Protein T-cell antigen receptor [49125] (6 species)
  7. 290129Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (5 PDB entries)
  8. 290132Domain d1mwac2: 1mwa C:118-213 [79563]
    Other proteins in same PDB: d1mwaa1, d1mwab1, d1mwac1, d1mwad1, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_
    complexed with acy, gol, man, nag

Details for d1mwac2

PDB Entry: 1mwa (more details), 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex

SCOP Domain Sequences for d1mwac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwac2 b.1.1.2 (C:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

SCOP Domain Coordinates for d1mwac2:

Click to download the PDB-style file with coordinates for d1mwac2.
(The format of our PDB-style files is described here.)

Timeline for d1mwac2: