SCOP 1.63: Domain d1mwac2: 1mwa C:118-213

Lineage for d1mwac2 (1mwa C:118-213)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (5 PDB entries)

8. Domain d1mwac2: 1mwa C:118-213 [79563]
   Other proteins in same PDB: d1mwaa1, d1mwab1, d1mwac1, d1mwad1, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_
   complexed with acy, gol, man, nag

Details for d1mwac2

PDB Entry: 1mwa, 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex

SCOP Domain Sequences for d1mwac2:

Sequence; same for both SEQRES and ATOM records:

>d1mwac2 b.1.1.2 (C:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

Timeline for d1mwac2:

• d1mwac2 is new in SCOP 1.63
  
• d1mwac2 appears in SCOP 1.65
  
• d1mwac2 appears in the current release, SCOPe 2.08