Lineage for d1mwab1 (1mwa B:1-117)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105447Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1105586Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries)
  8. 1105617Domain d1mwab1: 1mwa B:1-117 [79560]
    Other proteins in same PDB: d1mwaa2, d1mwab2, d1mwac2, d1mwad2, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_
    complexed with acy, gol, nag

Details for d1mwab1

PDB Entry: 1mwa (more details), 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex
PDB Compounds: (B:) 2c t cell receptor beta chain

SCOPe Domain Sequences for d1mwab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwab1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle

SCOPe Domain Coordinates for d1mwab1:

Click to download the PDB-style file with coordinates for d1mwab1.
(The format of our PDB-style files is described here.)

Timeline for d1mwab1: