![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein T-cell antigen receptor [49125] (6 species) |
![]() | Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (5 PDB entries) |
![]() | Domain d1mwaa2: 1mwa A:118-213 [79559] Other proteins in same PDB: d1mwaa1, d1mwab1, d1mwac1, d1mwad1, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_ |
PDB Entry: 1mwa (more details), 2.4 Å
SCOP Domain Sequences for d1mwaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwaa2 b.1.1.2 (A:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain} iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng aiawsnqtsftcqdifketnatypssdvpc
Timeline for d1mwaa2: