![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (15 PDB entries) |
![]() | Domain d1mwaa1: 1mwa A:1-117 [79558] Other proteins in same PDB: d1mwaa2, d1mwab2, d1mwac2, d1mwad2, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_ |
PDB Entry: 1mwa (more details), 2.4 Å
SCOP Domain Sequences for d1mwaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwaa1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain} qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy
Timeline for d1mwaa1: