Lineage for d1mwaa1 (1mwa A:1-117)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288452Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 288489Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (15 PDB entries)
  8. 288504Domain d1mwaa1: 1mwa A:1-117 [79558]
    Other proteins in same PDB: d1mwaa2, d1mwab2, d1mwac2, d1mwad2, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_

Details for d1mwaa1

PDB Entry: 1mwa (more details), 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex

SCOP Domain Sequences for d1mwaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwaa1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy

SCOP Domain Coordinates for d1mwaa1:

Click to download the PDB-style file with coordinates for d1mwaa1.
(The format of our PDB-style files is described here.)

Timeline for d1mwaa1: