Lineage for d1mw0a1 (1mw0 A:555-628)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810350Protein Amylosucrase [69328] (1 species)
  7. 2810351Species Neisseria polysaccharea [TaxId:489] [69329] (10 PDB entries)
  8. 2810357Domain d1mw0a1: 1mw0 A:555-628 [79549]
    Other proteins in same PDB: d1mw0a2, d1mw0a3
    complexed with dtt; mutant

Details for d1mw0a1

PDB Entry: 1mw0 (more details), 2.01 Å

PDB Description: amylosucrase mutant e328q co-crystallized with maltoheptaose then soaked with maltoheptaose.
PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d1mw0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mw0a1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

SCOPe Domain Coordinates for d1mw0a1:

Click to download the PDB-style file with coordinates for d1mw0a1.
(The format of our PDB-style files is described here.)

Timeline for d1mw0a1: