Class b: All beta proteins [48724] (149 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (3 families) duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins) contains metal-binding preSET and postSET domains |
Protein SET domain of Clr4 [82203] (1 species) ortholog of Dim-5 |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82204] (2 PDB entries) |
Domain d1mvxa_: 1mvx A: [79546] complexed with ni, so4, zn |
PDB Entry: 1mvx (more details), 3 Å
SCOP Domain Sequences for d1mvxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mvxa_ b.85.7.1 (A:) SET domain of Clr4 {Fission yeast (Schizosaccharomyces pombe)} kldsythlsfyekrelfrkklreiegpevtlvnevddepcpsldfqfisqyrltqgvipp dpnfqsgcncsslggcdlnnpsrceclddldepthfaydaqgrvradtgaviyecnsfcs csmecpnrvvqrgrtlpleifktkekgwgvrslrfapagtfitcylgevitsaeaakrdk nydddgitylfdldmfddaseytvdaqnygdvsrffnhscspniaiysavrnhgfrtiyd laffaikdiqpleeltfdyagakdfspvq
Timeline for d1mvxa_: