SCOP 1.71: Domain d1mvxa_: 1mvx A:

Lineage for d1mvxa_ (1mvx A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (3 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
   contains metal-binding preSET and postSET domains

6. Protein SET domain of Clr4 [82203] (1 species)
   ortholog of Dim-5

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82204] (2 PDB entries)

8. Domain d1mvxa_: 1mvx A: [79546]
   complexed with ni, so4, zn

Details for d1mvxa_

PDB Entry: 1mvx, 3 Å

PDB Description: structure of the SET domain histone lysine methyltransferase Clr4

SCOP Domain Sequences for d1mvxa_:

Sequence; same for both SEQRES and ATOM records:

>d1mvxa_ b.85.7.1 (A:) SET domain of Clr4 {Fission yeast (Schizosaccharomyces pombe)}
kldsythlsfyekrelfrkklreiegpevtlvnevddepcpsldfqfisqyrltqgvipp
dpnfqsgcncsslggcdlnnpsrceclddldepthfaydaqgrvradtgaviyecnsfcs
csmecpnrvvqrgrtlpleifktkekgwgvrslrfapagtfitcylgevitsaeaakrdk
nydddgitylfdldmfddaseytvdaqnygdvsrffnhscspniaiysavrnhgfrtiyd
laffaikdiqpleeltfdyagakdfspvq

Timeline for d1mvxa_:

• d1mvxa_ first appeared in SCOP 1.63
  
• d1mvxa_ appears in SCOP 1.69
  
• d1mvxa_ appears in SCOP 1.73
  
• d1mvxa_ appears in the current release, SCOPe 2.08