Lineage for d1mvwn_ (1mvw N:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 898427Fold i.15: Muscle protein complexes [64616] (1 superfamily)
  4. 898428Superfamily i.15.1: Muscle protein complexes [64617] (1 family) (S)
  5. 898429Family i.15.1.1: Muscle protein complexes [64618] (3 proteins)
  6. 898434Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species)
  7. 898435Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries)
  8. 898536Domain d1mvwn_: 1mvw N: [79536]

Details for d1mvwn_

PDB Entry: 1mvw (more details), 70 Å

PDB Description: molecular models of averaged rigor crossbridges from tomograms of insect flight muscle
PDB Compounds: (N:) skeletal muscle myosin II regulatory; light chain

SCOP Domain Sequences for d1mvwn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mvwn_ i.15.1.1 (N:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId: 9031]}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda

SCOP Domain Coordinates for d1mvwn_:

Click to download the PDB-style file with coordinates for d1mvwn_.
(The format of our PDB-style files is described here.)

Timeline for d1mvwn_: