|  | Class i: Low resolution protein structures [58117] (18 folds) | 
|  | Fold i.15: Muscle protein complexes [64616] (1 superfamily) | 
|  | Superfamily i.15.1: Muscle protein complexes [64617] (1 family)  | 
|  | Family i.15.1.1: Muscle protein complexes [64618] (2 proteins) | 
|  | Protein Averaged rigor crossbridges from tomograms of insect flight muscle [82952] (1 species) | 
|  | Species Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus) [TaxId:9031] [82953] (11 PDB entries) | 
|  | Domain d1mvwb_: 1mvw B: [79524] | 
PDB Entry: 1mvw (more details)
SCOP Domain Sequences for d1mvwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mvwb_ i.15.1.1 (B:) Averaged rigor crossbridges from tomograms of insect flight muscle {Chicken (Gallus gallus) and Rabbit (Oryctolagus cuniculus)}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda
Timeline for d1mvwb_:
|  View in 3D Domains from other chains: (mouse over for more information) d1mvw1_, d1mvw2_, d1mvw3_, d1mvw4_, d1mvw5_, d1mvw6_, d1mvw7_, d1mvw8_, d1mvw9_, d1mvwa_, d1mvwc_, d1mvwd_, d1mvwe_, d1mvwf_, d1mvwg_, d1mvwh_, d1mvwi_, d1mvwj_, d1mvwk_, d1mvwl_, d1mvwm_, d1mvwn_, d1mvwo_, d1mvwp_, d1mvwq_, d1mvwr_, d1mvwv_, d1mvww_, d1mvwx_, d1mvwy_, d1mvwz_ |