Lineage for d1mvoa_ (1mvo A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 311051Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 311052Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 311053Family c.23.1.1: CheY-related [52173] (13 proteins)
  6. 311144Protein PhoP receiver domain [82340] (1 species)
  7. 311145Species Bacillus subtilis [TaxId:1423] [82341] (1 PDB entry)
  8. 311146Domain d1mvoa_: 1mvo A: [79513]
    complexed with mn, na

Details for d1mvoa_

PDB Entry: 1mvo (more details), 1.6 Å

PDB Description: Crystal structure of the PhoP receiver domain from Bacillus subtilis

SCOP Domain Sequences for d1mvoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis}
mnkkilvvddeesivtllqynlersgydvitasdgeealkkaetekpdlivldvmlpkld
gievckqlrqqklmfpilmltakdeefdkvlglelgaddymtkpfsprevnarvkailrr
s

SCOP Domain Coordinates for d1mvoa_:

Click to download the PDB-style file with coordinates for d1mvoa_.
(The format of our PDB-style files is described here.)

Timeline for d1mvoa_: