Lineage for d1mvki_ (1mvk I:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639448Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1639449Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1639474Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)
  7. 1639485Species Streptococcus sp., group G [TaxId:1306] [54361] (32 PDB entries)
  8. 1639510Domain d1mvki_: 1mvk I: [79509]
    X-ray structure of the intertwined tetramer resulted from a core mutation
    complexed with so4; mutant

Details for d1mvki_

PDB Entry: 1mvk (more details), 2.5 Å

PDB Description: x-ray structure of the tetrameric mutant of the b1 domain of streptococcal protein g
PDB Compounds: (I:) immunoglobulin g binding protein g

SCOPe Domain Sequences for d1mvki_:

Sequence, based on SEQRES records: (download)

>d1mvki_ d.15.7.1 (I:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte

Sequence, based on observed residues (ATOM records): (download)

>d1mvki_ d.15.7.1 (I:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilngteavdaatfekvvkqffndngvdgewtyddatktftvte

SCOPe Domain Coordinates for d1mvki_:

Click to download the PDB-style file with coordinates for d1mvki_.
(The format of our PDB-style files is described here.)

Timeline for d1mvki_: