Lineage for d1mvkg_ (1mvk G:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2160552Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2160553Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 protein domains)
  6. 2160578Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2160591Species Streptococcus sp., group G [TaxId:1306] [54361] (35 PDB entries)
  8. 2160614Domain d1mvkg_: 1mvk G: [79507]
    X-ray structure of the intertwined tetramer resulted from a core mutation
    complexed with so4; mutant

Details for d1mvkg_

PDB Entry: 1mvk (more details), 2.5 Å

PDB Description: x-ray structure of the tetrameric mutant of the b1 domain of streptococcal protein g
PDB Compounds: (G:) immunoglobulin g binding protein g

SCOPe Domain Sequences for d1mvkg_:

Sequence, based on SEQRES records: (download)

>d1mvkg_ d.15.7.1 (G:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte

Sequence, based on observed residues (ATOM records): (download)

>d1mvkg_ d.15.7.1 (G:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilngeavdaatfekvvkqffndngvdgewtyddatktftvte

SCOPe Domain Coordinates for d1mvkg_:

Click to download the PDB-style file with coordinates for d1mvkg_.
(The format of our PDB-style files is described here.)

Timeline for d1mvkg_: