Lineage for d1mvkf_ (1mvk F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934668Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2934705Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries)
  8. 2934735Domain d1mvkf_: 1mvk F: [79506]
    X-ray structure of the intertwined tetramer resulted from a core mutation
    complexed with so4; mutant

Details for d1mvkf_

PDB Entry: 1mvk (more details), 2.5 Å

PDB Description: x-ray structure of the tetrameric mutant of the b1 domain of streptococcal protein g
PDB Compounds: (F:) immunoglobulin g binding protein g

SCOPe Domain Sequences for d1mvkf_:

Sequence, based on SEQRES records: (download)

>d1mvkf_ d.15.7.1 (F:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte

Sequence, based on observed residues (ATOM records): (download)

>d1mvkf_ d.15.7.1 (F:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilneavdaatfekvvkqffndngvdgewtyddatktftvte

SCOPe Domain Coordinates for d1mvkf_:

Click to download the PDB-style file with coordinates for d1mvkf_.
(The format of our PDB-style files is described here.)

Timeline for d1mvkf_: