Lineage for d1mvka_ (1mvk A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403793Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1403794Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1403819Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)
  7. 1403828Species Streptococcus sp., group G [TaxId:1306] [54361] (31 PDB entries)
  8. 1403845Domain d1mvka_: 1mvk A: [79501]
    X-ray structure of the intertwined tetramer resulted from a core mutation
    complexed with so4; mutant

Details for d1mvka_

PDB Entry: 1mvk (more details), 2.5 Å

PDB Description: x-ray structure of the tetrameric mutant of the b1 domain of streptococcal protein g
PDB Compounds: (A:) immunoglobulin g binding protein g

SCOPe Domain Sequences for d1mvka_:

Sequence, based on SEQRES records: (download)

>d1mvka_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte

Sequence, based on observed residues (ATOM records): (download)

>d1mvka_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilneavdaatfekvvkqffndngvdgewtyddatktftvte

SCOPe Domain Coordinates for d1mvka_:

Click to download the PDB-style file with coordinates for d1mvka_.
(The format of our PDB-style files is described here.)

Timeline for d1mvka_: