Lineage for d1mvka_ (1mvk A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325904Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 325905Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 325929Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 325930Species Streptococcus sp., group G [TaxId:1306] [54361] (21 PDB entries)
  8. 325941Domain d1mvka_: 1mvk A: [79501]

Details for d1mvka_

PDB Entry: 1mvk (more details), 2.5 Å

PDB Description: x-ray structure of the tetrameric mutant of the b1 domain of streptococcal protein g

SCOP Domain Sequences for d1mvka_:

Sequence, based on SEQRES records: (download)

>d1mvka_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte

Sequence, based on observed residues (ATOM records): (download)

>d1mvka_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
mqykvilneavdaatfekvvkqffndngvdgewtyddatktftvte

SCOP Domain Coordinates for d1mvka_:

Click to download the PDB-style file with coordinates for d1mvka_.
(The format of our PDB-style files is described here.)

Timeline for d1mvka_: