Lineage for d1mvca_ (1mvc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342369Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2342370Species Human (Homo sapiens) [TaxId:9606] [48511] (39 PDB entries)
    Uniprot P19793 227-458
  8. 2342376Domain d1mvca_: 1mvc A: [79499]
    complexed with co-activator peptide
    complexed with bm6

Details for d1mvca_

PDB Entry: 1mvc (more details), 1.9 Å

PDB Description: Crystal structure of the human RXR alpha ligand binding domain bound to the synthetic agonist compound BMS 649 and a coactivator peptide
PDB Compounds: (A:) RXR retinoid X receptor

SCOPe Domain Sequences for d1mvca_:

Sequence, based on SEQRES records: (download)

>d1mvca_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
dmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriph
fselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdr
vltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhky
peqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Sequence, based on observed residues (ATOM records): (download)

>d1mvca_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
dmpverileaelavepdpvtnicqaadkqlftlvewakriphfselplddqvillragwn
elliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdkte
lgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalr
siglkclehlfffkligdtpidtflmemleap

SCOPe Domain Coordinates for d1mvca_:

Click to download the PDB-style file with coordinates for d1mvca_.
(The format of our PDB-style files is described here.)

Timeline for d1mvca_: