Lineage for d1muja2 (1muj A:0-83)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198436Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1198495Species Mouse (Mus musculus), I-AB [TaxId:10090] [88815] (2 PDB entries)
  8. 1198496Domain d1muja2: 1muj A:0-83 [79489]
    Other proteins in same PDB: d1muja1, d1mujb1, d1mujb2
    complex with a human clip peptide, chain C
    complexed with nag

Details for d1muja2

PDB Entry: 1muj (more details), 2.15 Å

PDB Description: crystal structure of murine class ii mhc i-ab in complex with a human clip peptide
PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d1muja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muja2 d.19.1.1 (A:0-83) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
dieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqg
glqniavvkhnlgvltkrsnstpat

SCOPe Domain Coordinates for d1muja2:

Click to download the PDB-style file with coordinates for d1muja2.
(The format of our PDB-style files is described here.)

Timeline for d1muja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1muja1