SCOPe 2.05: Domain d1mufa1: 1muf A:81-193

Lineage for d1mufa1 (1muf A:81-193)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family)
   11+ stranded sheet partly folded upon itself at the C-end

5. Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)

6. Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82188] (17 PDB entries)
   Uniprot Q8WTS6 52-366

8. Domain d1mufa1: 1muf A:81-193 [79483]
   Other proteins in same PDB: d1mufa2
   truncated from N-terminus

Details for d1mufa1

PDB Entry: 1muf, 2.26 Å

PDB Description: Structure of histone H3 K4-specific methyltransferase SET7/9

PDB Compounds: (A:) set9

SCOPe Domain Sequences for d1mufa1:

Sequence; same for both SEQRES and ATOM records:

>d1mufa1 b.76.2.1 (A:81-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vlqgtyvdgelngpaqeydtdgrlifkgqykdnirhgvcwiyypdggslvgevnedgemt
gekiayvypdertalygkfidgemiegklatlmsteegrphfelmpgnsvyhf

Timeline for d1mufa1:

• d1mufa1 first appeared in SCOP 1.63
  
• d1mufa1 appears in SCOPe 2.04
  
• d1mufa1 appears in SCOPe 2.06
  
• d1mufa1 appears in the current release, SCOPe 2.08