![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily) beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234 |
![]() | Superfamily d.136.1: Phospholipase D/nuclease [56024] (3 families) ![]() |
![]() | Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (1 protein) |
![]() | Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69817] (12 PDB entries) |
![]() | Domain d1mu9b1: 1mu9 B:159-350 [79481] |
PDB Entry: 1mu9 (more details), 2.05 Å
SCOP Domain Sequences for d1mu9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mu9b1 d.136.1.3 (B:159-350) Tyrosyl-DNA phosphodiesterase TDP1 {Human (Homo sapiens)} dkgnpfqfyltrvsgvkpkynsgalhikdilsplfgtlvssaqfnycfdvdwlvkqyppe frkkpillvhgdkreakahlhaqakpyenislcqakldiafgthhtkmmlllyeeglrvv ihtsnlihadwhqktqgiwlsplypriadgthksgespthfkanlisyltaynapslkew idvihkhdlset
Timeline for d1mu9b1: