Lineage for d1mu2b_ (1mu2 B:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618192Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 618193Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 618312Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 618313Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 618488Species Human immunodeficiency virus type 2 [TaxId:11709] [82840] (1 PDB entry)
  8. 618490Domain d1mu2b_: 1mu2 B: [79471]
    Other proteins in same PDB: d1mu2a1
    complexed with gol, so4; mutant

Details for d1mu2b_

PDB Entry: 1mu2 (more details), 2.35 Å

PDB Description: crystal structure of hiv-2 reverse transcriptase
PDB Compounds: (B:)

SCOP Domain Sequences for d1mu2b_:

Sequence, based on SEQRES records: (download)

>d1mu2b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 2}
epikimlkpgkdgpklrqwpltkekiealkeicekmekegqleeapptnpyntptfaikk
kdknkwrmlidfrelnkvtqdfteiqlgiphpaglakkrritvldvgdayfsiplhedfr
pytaftlpsvnnaepgkryiykvlpqgwkgspaifqhtmrqvlepfrkankdviiiqymd
diliasdrtdlehdrvvlqlkellnglgfstpdekfqkdppyhwmgyelwptkwklqkiq
lpqkeiwtvndiqklvgvlnwaaqlypgiktkhlcrlisgkmtlteevqwtelaeaelee
nriilsqeqeghyyqeekeleatvqkdqdnqwtykihqeekilkvgkyakvknthtngir
llaqvvqkigkealviwgripkfhlpvereiweqwwdnywqvtwipdwdfvstpplvrla
fnlvgd

Sequence, based on observed residues (ATOM records): (download)

>d1mu2b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 2}
epikimlkpgkdgpklrqwpltkekiealkeicekmekegqleeapptnpyntptfaikn
kwrmlidfrelnkvtqdfteiqphpaglakkrritvldvgdayfsiplhedfrpytaftl
psvnnaepgkryiykvlpqgwkgspaifqhtmrqvlepfrkankdviiiqymddiliasd
rtdlehdrvvlqlkellngwmgyelwptkwklqkiqlpqkeiwtvndiqklvgvlnwaaq
lypgiktkhlcrlisgkmtlteevqwtelaeaeleenriilsqeqeghyyqeekeleatv
qkdqdnqwtykihqeekilkvgkyakvknthtngirllaqvvqkigkealviwgripkfh
lpvereiweqwwdnywqvtwipdwdfvstpplvrlafnlvgd

SCOP Domain Coordinates for d1mu2b_:

Click to download the PDB-style file with coordinates for d1mu2b_.
(The format of our PDB-style files is described here.)

Timeline for d1mu2b_: