![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.2: Reverse transcriptase [56686] (2 proteins) |
![]() | Protein HIV-1 reverse transcriptase [56689] (2 species) |
![]() | Species Human immunodeficiency virus type 2 [TaxId:11709] [82840] (1 PDB entry) |
![]() | Domain d1mu2a2: 1mu2 A:3-429 [79470] Other proteins in same PDB: d1mu2a1 complexed with gol, so4; mutant |
PDB Entry: 1mu2 (more details), 2.35 Å
SCOP Domain Sequences for d1mu2a2:
Sequence, based on SEQRES records: (download)
>d1mu2a2 e.8.1.2 (A:3-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 2 [TaxId: 11709]} akvepikimlkpgkdgpklrqwpltkekiealkeicekmekegqleeapptnpyntptfa ikkkdknkwrmlidfrelnkvtqdfteiqlgiphpaglakkrritvldvgdayfsiplhe dfrpytaftlpsvnnaepgkryiykvlpqgwkgspaifqhtmrqvlepfrkankdviiiq ymddiliasdrtdlehdrvvlqlkellnglgfstpdekfqkdppyhwmgyelwptkwklq kiqlpqkeiwtvndiqklvgvlnwaaqlypgiktkhlcrlisgkmtlteevqwtelaeae leenriilsqeqeghyyqeekeleatvqkdqdnqwtykihqeekilkvgkyakvknthtn girllaqvvqkigkealviwgripkfhlpvereiweqwwdnywqvtwipdwdfvstpplv rlafnlv
>d1mu2a2 e.8.1.2 (A:3-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 2 [TaxId: 11709]} akvepikimlkpgkdgpklrqwpltkekiealkeicekmekegqleeapptnpyntptfa ikkkdrmlidfrelnkvtqdfteiqlgiphpaglakkrritvldvgdayfsiplhedfrp ytaftlkryiykvlpqgwkgspaifqhtmrqvlepfrkankdviiiqymddiliasdrtd lehdrvvlqlkellnglgfstpdekfqkdppyhwmgyelwptkwklqkiqlpqkeiwtvn diqklvgvlnwaaqlypgiktkhlcrlisgkmtlteevqwtelaeaeleenriilsqeqe ghyyqeekeleatvqkdqdnqwtykihqeekilkvgkyakvthtngirllaqvvqkigke alviwgripkfhlpvereiweqwwdnywqvtwipdwdfvstpplvrlafnlv
Timeline for d1mu2a2: