SCOPe 2.07: Domain d1mu2a1: 1mu2 A:430-555

Lineage for d1mu2a1 (1mu2 A:430-555)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 2 [TaxId:11709] [82443] (1 PDB entry)

8. Domain d1mu2a1: 1mu2 A:430-555 [79469]
   Other proteins in same PDB: d1mu2a2, d1mu2b_
   complexed with gol, so4

Details for d1mu2a1

PDB Entry: 1mu2, 2.35 Å

PDB Description: crystal structure of hiv-2 reverse transcriptase

PDB Compounds: (A:) hiv-2 rt

SCOPe Domain Sequences for d1mu2a1:

Sequence; same for both SEQRES and ATOM records:

>d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]}
gdpipgaetfytdgscnrqskegkagyvtdrgkdkvkkleqttnqqaeleafamaltdsg
pkvniivdsqyvmgivasqpteseskivnqiieemikkeaiyvawvpahkgiggnqevdh
lvsqgi

Timeline for d1mu2a1:

• d1mu2a1 first appeared in SCOP 1.63
  
• d1mu2a1 appears in SCOPe 2.06
  
• d1mu2a1 appears in the current release, SCOPe 2.08