Lineage for d1mu2a1 (1mu2 A:430-555)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 246267Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
    consists of one domain of this fold
  5. 246268Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 246278Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 246351Species Human immunodeficiency virus type 2 [TaxId:11709] [82443] (1 PDB entry)
  8. 246352Domain d1mu2a1: 1mu2 A:430-555 [79469]
    Other proteins in same PDB: d1mu2a2, d1mu2b_
    complexed with gol, so4; mutant

Details for d1mu2a1

PDB Entry: 1mu2 (more details), 2.35 Å

PDB Description: crystal structure of hiv-2 reverse transcriptase

SCOP Domain Sequences for d1mu2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2}
gdpipgaetfytdgscnrqskegkagyvtdrgkdkvkkleqttnqqaeleafamaltdsg
pkvniivdsqyvmgivasqpteseskivnqiieemikkeaiyvawvpahkgiggnqevdh
lvsqgi

SCOP Domain Coordinates for d1mu2a1:

Click to download the PDB-style file with coordinates for d1mu2a1.
(The format of our PDB-style files is described here.)

Timeline for d1mu2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mu2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1mu2b_