Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species) |
Species Human immunodeficiency virus type 2 [TaxId:11709] [82443] (1 PDB entry) |
Domain d1mu2a1: 1mu2 A:430-555 [79469] Other proteins in same PDB: d1mu2a2, d1mu2b_ complexed with gol, so4 |
PDB Entry: 1mu2 (more details), 2.35 Å
SCOPe Domain Sequences for d1mu2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} gdpipgaetfytdgscnrqskegkagyvtdrgkdkvkkleqttnqqaeleafamaltdsg pkvniivdsqyvmgivasqpteseskivnqiieemikkeaiyvawvpahkgiggnqevdh lvsqgi
Timeline for d1mu2a1: