Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.89: Phosphofructokinase [53783] (1 superfamily) consists of two non-similar domains, 3 layers (a/b/a) each Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest Domain 2 has parallel sheet of 4 strands, order 2314 |
Superfamily c.89.1: Phosphofructokinase [53784] (1 family) |
Family c.89.1.1: Phosphofructokinase [53785] (2 proteins) |
Protein ATP-dependent phosphofructokinase [53786] (2 species) Domain 1 binds ATP |
Species Bacillus stearothermophilus [TaxId:1422] [53788] (4 PDB entries) |
Domain d1mtoh_: 1mto H: [79465] complexed with f6p; mutant |
PDB Entry: 1mto (more details), 3.2 Å
SCOP Domain Sequences for d1mtoh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mtoh_ c.89.1.1 (H:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus} mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi ihrggtilytarcpefkteegqkkgieqlkkhgieglvviggdgsyqgakkltehgfpcv gvpgtidndipgtdftigfdtalntvidaidkirdtatshertwvievmgrhagdialys glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal ankhtidqrmyalskelsi
Timeline for d1mtoh_: