Lineage for d1mtob_ (1mto B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 250399Fold c.89: Phosphofructokinase [53783] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
    Domain 2 has parallel sheet of 4 strands, order 2314
  4. 250400Superfamily c.89.1: Phosphofructokinase [53784] (1 family) (S)
  5. 250401Family c.89.1.1: Phosphofructokinase [53785] (2 proteins)
  6. 250402Protein ATP-dependent phosphofructokinase [53786] (2 species)
    Domain 1 binds ATP
  7. 250403Species Bacillus stearothermophilus [TaxId:1422] [53788] (4 PDB entries)
  8. 250411Domain d1mtob_: 1mto B: [79459]

Details for d1mtob_

PDB Entry: 1mto (more details), 3.2 Å

PDB Description: crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate

SCOP Domain Sequences for d1mtob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mtob_ c.89.1.1 (B:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus}
mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
ihrggtilytarcpefkteegqkkgieqlkkhgieglvviggdgsyqgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdtatshertwvievmgrhagdialys
glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
ankhtidqrmyalskelsi

SCOP Domain Coordinates for d1mtob_:

Click to download the PDB-style file with coordinates for d1mtob_.
(The format of our PDB-style files is described here.)

Timeline for d1mtob_: