Lineage for d1mtoa_ (1mto A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519106Fold c.89: Phosphofructokinase [53783] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
    Domain 2 has parallel sheet of 4 strands, order 2314
  4. 2519107Superfamily c.89.1: Phosphofructokinase [53784] (2 families) (S)
  5. 2519108Family c.89.1.1: Phosphofructokinase [53785] (3 proteins)
  6. 2519109Protein ATP-dependent phosphofructokinase [53786] (2 species)
    Domain 1 binds ATP
  7. 2519110Species Bacillus stearothermophilus [TaxId:1422] [53788] (8 PDB entries)
  8. 2519129Domain d1mtoa_: 1mto A: [79458]
    complexed with f6p; mutant

Details for d1mtoa_

PDB Entry: 1mto (more details), 3.2 Å

PDB Description: crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate
PDB Compounds: (A:) 6-phosphofructokinase

SCOPe Domain Sequences for d1mtoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mtoa_ c.89.1.1 (A:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus [TaxId: 1422]}
mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
ihrggtilytarcpefkteegqkkgieqlkkhgieglvviggdgsyqgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdtatshertwvievmgrhagdialys
glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
ankhtidqrmyalskelsi

SCOPe Domain Coordinates for d1mtoa_:

Click to download the PDB-style file with coordinates for d1mtoa_.
(The format of our PDB-style files is described here.)

Timeline for d1mtoa_: