SCOP 1.63: Domain d1mtbb_: 1mtb B:

Lineage for d1mtbb_ (1mtb B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (151 PDB entries)

8. Domain d1mtbb_: 1mtb B: [79455]
   complexed with asn, diq, hph, ntb, qnc; mutant

Details for d1mtbb_

PDB Entry: 1mtb, 2.5 Å

PDB Description: viability of a drug-resistant hiv-1 protease mutant: structural insights for better antiviral therapy

SCOP Domain Sequences for d1mtbb_:

Sequence; same for both SEQRES and ATOM records:

>d1mtbb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d1mtbb_:

• d1mtbb_ is new in SCOP 1.63
  
• d1mtbb_ appears in SCOP 1.65
  
• d1mtbb_ appears in the current release, SCOPe 2.08