SCOPe 2.05: Domain d1mt6a2: 1mt6 A:194-337

Lineage for d1mt6a2 (1mt6 A:194-337)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
   contains metal-binding preSET and postSET domains

6. Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82206] (17 PDB entries)
   Uniprot Q8WTS6 52-336

8. Domain d1mt6a2: 1mt6 A:194-337 [79447]
   Other proteins in same PDB: d1mt6a1
   complexed with sah

Details for d1mt6a2

PDB Entry: 1mt6, 2.2 Å

PDB Description: Structure of histone H3 K4-specific methyltransferase SET7/9 with AdoHcy

PDB Compounds: (A:) set9

SCOPe Domain Sequences for d1mt6a2:

Sequence; same for both SEQRES and ATOM records:

>d1mt6a2 b.85.7.1 (A:194-337) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygy

Timeline for d1mt6a2:

• d1mt6a2 first appeared in SCOP 1.63
  
• d1mt6a2 appears in SCOPe 2.04
  
• d1mt6a2 appears in SCOPe 2.06
  
• d1mt6a2 appears in the current release, SCOPe 2.08