![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.7: SET domain [82199] (3 families) ![]() duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
![]() | Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins) contains metal-binding preSET and postSET domains |
![]() | Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82206] (6 PDB entries) |
![]() | Domain d1mt6a2: 1mt6 A:194-337 [79447] Other proteins in same PDB: d1mt6a1 |
PDB Entry: 1mt6 (more details), 2.2 Å
SCOP Domain Sequences for d1mt6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mt6a2 b.85.7.1 (A:194-337) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens)} dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf gpikcirtlraveadeeltvaygy
Timeline for d1mt6a2: