SCOPe 2.07: Domain d1mt6a1: 1mt6 A:58-193

Lineage for d1mt6a1 (1mt6 A:58-193)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family)
   11+ stranded sheet partly folded upon itself at the C-end

5. Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)

6. Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82188] (19 PDB entries)
   Uniprot Q8WTS6 52-366

8. Domain d1mt6a1: 1mt6 A:58-193 [79446]
   Other proteins in same PDB: d1mt6a2
   complexed with sah

Details for d1mt6a1

PDB Entry: 1mt6, 2.2 Å

PDB Description: Structure of histone H3 K4-specific methyltransferase SET7/9 with AdoHcy

PDB Compounds: (A:) set9

SCOPe Domain Sequences for d1mt6a1:

Sequence; same for both SEQRES and ATOM records:

>d1mt6a1 b.76.2.1 (A:58-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tlegyyvddalqgqgvytyedggvlqgtyvdgelngpaqeydtdgrlifkgqykdnirhg
vcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmstee
grphfelmpgnsvyhf

Timeline for d1mt6a1:

• d1mt6a1 first appeared in SCOP 1.63
  
• d1mt6a1 appears in SCOPe 2.06
  
• d1mt6a1 appears in the current release, SCOPe 2.08