Lineage for d1mt6a1 (1mt6 A:58-193)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068816Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2068846Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 2068847Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 2068848Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 2068849Species Human (Homo sapiens) [TaxId:9606] [82188] (18 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 2068868Domain d1mt6a1: 1mt6 A:58-193 [79446]
    Other proteins in same PDB: d1mt6a2
    complexed with sah

Details for d1mt6a1

PDB Entry: 1mt6 (more details), 2.2 Å

PDB Description: Structure of histone H3 K4-specific methyltransferase SET7/9 with AdoHcy
PDB Compounds: (A:) set9

SCOPe Domain Sequences for d1mt6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mt6a1 b.76.2.1 (A:58-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tlegyyvddalqgqgvytyedggvlqgtyvdgelngpaqeydtdgrlifkgqykdnirhg
vcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmstee
grphfelmpgnsvyhf

SCOPe Domain Coordinates for d1mt6a1:

Click to download the PDB-style file with coordinates for d1mt6a1.
(The format of our PDB-style files is described here.)

Timeline for d1mt6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mt6a2