Lineage for d1mt5e_ (1mt5 E:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 251647Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 251648Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
  5. 251649Family c.117.1.1: Amidase signature (AS) enzymes [75305] (3 proteins)
  6. 251650Protein Fatty acid amide hydrolase (oleamide hydrolase) [82531] (1 species)
    elaborated fold with additional helices
  7. 251651Species Rat (Rattus norvegicus) [TaxId:10116] [82532] (1 PDB entry)
  8. 251656Domain d1mt5e_: 1mt5 E: [79434]

Details for d1mt5e_

PDB Entry: 1mt5 (more details), 2.8 Å

PDB Description: crystal structure of fatty acid amide hydrolase

SCOP Domain Sequences for d1mt5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mt5e_ c.117.1.1 (E:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus)}
argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt

SCOP Domain Coordinates for d1mt5e_:

Click to download the PDB-style file with coordinates for d1mt5e_.
(The format of our PDB-style files is described here.)

Timeline for d1mt5e_: