Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily) possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) automatically mapped to Pfam PF01425 |
Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins) |
Protein Fatty acid amide hydrolase (oleamide hydrolase) [82531] (1 species) elaborated fold with additional helices |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [82532] (1 PDB entry) |
Domain d1mt5c_: 1mt5 C: [79432] complexed with may |
PDB Entry: 1mt5 (more details), 2.8 Å
SCOPe Domain Sequences for d1mt5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mt5c_ c.117.1.1 (C:) Fatty acid amide hydrolase (oleamide hydrolase) {Norway rat (Rattus norvegicus) [TaxId: 10116]} argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
Timeline for d1mt5c_: