Lineage for d1mt5c_ (1mt5 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884850Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1884851Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
    automatically mapped to Pfam PF01425
  5. 1884852Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins)
  6. 1884853Protein Fatty acid amide hydrolase (oleamide hydrolase) [82531] (1 species)
    elaborated fold with additional helices
  7. 1884854Species Norway rat (Rattus norvegicus) [TaxId:10116] [82532] (1 PDB entry)
  8. 1884857Domain d1mt5c_: 1mt5 C: [79432]
    complexed with may

Details for d1mt5c_

PDB Entry: 1mt5 (more details), 2.8 Å

PDB Description: crystal structure of fatty acid amide hydrolase
PDB Compounds: (C:) Fatty-acid amide hydrolase

SCOPe Domain Sequences for d1mt5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mt5c_ c.117.1.1 (C:) Fatty acid amide hydrolase (oleamide hydrolase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt

SCOPe Domain Coordinates for d1mt5c_:

Click to download the PDB-style file with coordinates for d1mt5c_.
(The format of our PDB-style files is described here.)

Timeline for d1mt5c_: