Lineage for d1mrsa_ (1mrs A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2446889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2447355Protein Thymidylate kinase [52563] (5 species)
  7. 2447393Species Mycobacterium tuberculosis [TaxId:1773] [69482] (9 PDB entries)
  8. 2447399Domain d1mrsa_: 1mrs A: [79424]
    complexed with 5hu, mg, so4

Details for d1mrsa_

PDB Entry: 1mrs (more details), 2 Å

PDB Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with 5-ch2oh deoxyuridine monophosphate
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d1mrsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrsa_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatla

SCOPe Domain Coordinates for d1mrsa_:

Click to download the PDB-style file with coordinates for d1mrsa_.
(The format of our PDB-style files is described here.)

Timeline for d1mrsa_: