Lineage for d1mr3f_ (1mr3 F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1845935Protein ADP-ribosylation factor [52614] (16 species)
  7. 1845936Species Baker's yeast (Saccharomyces cerevisiae), ARF2 [TaxId:4932] [82401] (1 PDB entry)
  8. 1845937Domain d1mr3f_: 1mr3 F: [79422]
    complexed with edo, eoh, g3d, gol, mg, pdo

Details for d1mr3f_

PDB Entry: 1mr3 (more details), 1.6 Å

PDB Description: saccharomyces cerevisiae adp-ribosylation factor 2 (scarf2) complexed with gdp-3'p at 1.6a resolution
PDB Compounds: (F:) ADP-ribosylation factor 2

SCOPe Domain Sequences for d1mr3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mr3f_ c.37.1.8 (F:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARF2 [TaxId: 4932]}
asklfsnlfgnkemrilmvgldgagkttvlyklklgevittiptigfnvetvqyknisft
vwdvggqdrirslwrhyyrntegvifvidsndrsrigearevmqrmlnedelrnavwlvf
ankqdlpeamsaaeiteklglhsirnrpwfiqstcatsgeglyeglewlsnnlknqs

SCOPe Domain Coordinates for d1mr3f_:

Click to download the PDB-style file with coordinates for d1mr3f_.
(The format of our PDB-style files is described here.)

Timeline for d1mr3f_: