Lineage for d1mr1d_ (1mr1 D:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516089Fold d.217: SAND domain-like [63762] (1 superfamily)
    core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold
  4. 516090Superfamily d.217.1: SAND domain-like [63763] (2 families) (S)
  5. 516102Family d.217.1.2: SMAD4-binding domain of oncoprotein Ski [82611] (1 protein)
  6. 516103Protein SMAD4-binding domain of oncoprotein Ski [82612] (1 species)
  7. 516104Species Human (Homo sapiens) [TaxId:9606] [82613] (1 PDB entry)
  8. 516106Domain d1mr1d_: 1mr1 D: [79421]
    Other proteins in same PDB: d1mr1a_, d1mr1b_
    complex with SMAD4 domain

Details for d1mr1d_

PDB Entry: 1mr1 (more details), 2.85 Å

PDB Description: Crystal Structure of a Smad4-Ski Complex

SCOP Domain Sequences for d1mr1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mr1d_ d.217.1.2 (D:) SMAD4-binding domain of oncoprotein Ski {Human (Homo sapiens)}
hmrvyhecfgkckgllvpelysspsaaciqcldcrlmypphkfvvhshkalenrtchwgf
dsanwrayillsqdytgkeeqarlgrclddvkekfd

SCOP Domain Coordinates for d1mr1d_:

Click to download the PDB-style file with coordinates for d1mr1d_.
(The format of our PDB-style files is described here.)

Timeline for d1mr1d_: