Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.217: SAND domain-like [63762] (1 superfamily) core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold |
Superfamily d.217.1: SAND domain-like [63763] (2 families) |
Family d.217.1.2: SMAD4-binding domain of oncoprotein Ski [82611] (1 protein) |
Protein SMAD4-binding domain of oncoprotein Ski [82612] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82613] (1 PDB entry) |
Domain d1mr1d_: 1mr1 D: [79421] Other proteins in same PDB: d1mr1a_, d1mr1b_ complex with SMAD4 domain |
PDB Entry: 1mr1 (more details), 2.85 Å
SCOP Domain Sequences for d1mr1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mr1d_ d.217.1.2 (D:) SMAD4-binding domain of oncoprotein Ski {Human (Homo sapiens)} hmrvyhecfgkckgllvpelysspsaaciqcldcrlmypphkfvvhshkalenrtchwgf dsanwrayillsqdytgkeeqarlgrclddvkekfd
Timeline for d1mr1d_: