SCOP 1.63: Domain d1mr1d_: 1mr1 D:

Lineage for d1mr1d_ (1mr1 D:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.217: SAND domain-like [63762] (1 superfamily)
   core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold

4. Superfamily d.217.1: SAND domain-like [63763] (2 families)

5. Family d.217.1.2: SMAD4-binding domain of oncoprotein Ski [82611] (1 protein)

6. Protein SMAD4-binding domain of oncoprotein Ski [82612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82613] (1 PDB entry)

8. Domain d1mr1d_: 1mr1 D: [79421]
   Other proteins in same PDB: d1mr1a_, d1mr1b_
   complex with SMAD4 domain
   complexed with zn

Details for d1mr1d_

PDB Entry: 1mr1, 2.85 Å

PDB Description: Crystal Structure of a Smad4-Ski Complex

SCOP Domain Sequences for d1mr1d_:

Sequence; same for both SEQRES and ATOM records:

>d1mr1d_ d.217.1.2 (D:) SMAD4-binding domain of oncoprotein Ski {Human (Homo sapiens)}
hmrvyhecfgkckgllvpelysspsaaciqcldcrlmypphkfvvhshkalenrtchwgf
dsanwrayillsqdytgkeeqarlgrclddvkekfd

Timeline for d1mr1d_:

• d1mr1d_ is new in SCOP 1.63
  
• d1mr1d_ appears in SCOP 1.65
  
• d1mr1d_ appears in the current release, SCOPe 2.08, called d1mr1d1