Lineage for d1mr1c_ (1mr1 C:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265778Fold d.217: SAND domain-like [63762] (1 superfamily)
    core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold
  4. 265779Superfamily d.217.1: SAND domain-like [63763] (2 families) (S)
  5. 265784Family d.217.1.2: SMAD4-binding domain of oncoprotein Ski [82611] (1 protein)
  6. 265785Protein SMAD4-binding domain of oncoprotein Ski [82612] (1 species)
  7. 265786Species Human (Homo sapiens) [TaxId:9606] [82613] (1 PDB entry)
  8. 265787Domain d1mr1c_: 1mr1 C: [79420]
    Other proteins in same PDB: d1mr1a_, d1mr1b_

Details for d1mr1c_

PDB Entry: 1mr1 (more details), 2.85 Å

PDB Description: Crystal Structure of a Smad4-Ski Complex

SCOP Domain Sequences for d1mr1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mr1c_ d.217.1.2 (C:) SMAD4-binding domain of oncoprotein Ski {Human (Homo sapiens)}
shmrvyhecfgkckgllvpelysspsaaciqcldcrlmypphkfvvhshkalenrtchwg
fdsanwrayillsqdytgkeeqarlgrclddvkekfd

SCOP Domain Coordinates for d1mr1c_:

Click to download the PDB-style file with coordinates for d1mr1c_.
(The format of our PDB-style files is described here.)

Timeline for d1mr1c_: