![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.217: SAND domain-like [63762] (1 superfamily) core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold |
![]() | Superfamily d.217.1: SAND domain-like [63763] (2 families) ![]() |
![]() | Family d.217.1.2: SMAD4-binding domain of oncoprotein Ski [82611] (1 protein) automatically mapped to Pfam PF08782 |
![]() | Protein SMAD4-binding domain of oncoprotein Ski [82612] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82613] (1 PDB entry) |
![]() | Domain d1mr1c1: 1mr1 C:219-312 [79420] Other proteins in same PDB: d1mr1a_, d1mr1b_, d1mr1c2, d1mr1d2 complex with SMAD4 domain complexed with zn |
PDB Entry: 1mr1 (more details), 2.85 Å
SCOPe Domain Sequences for d1mr1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mr1c1 d.217.1.2 (C:219-312) SMAD4-binding domain of oncoprotein Ski {Human (Homo sapiens) [TaxId: 9606]} rvyhecfgkckgllvpelysspsaaciqcldcrlmypphkfvvhshkalenrtchwgfds anwrayillsqdytgkeeqarlgrclddvkekfd
Timeline for d1mr1c1:
![]() Domains from other chains: (mouse over for more information) d1mr1a_, d1mr1b_, d1mr1d1, d1mr1d2 |