Lineage for d1mr1c1 (1mr1 C:219-312)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006848Fold d.217: SAND domain-like [63762] (1 superfamily)
    core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold
  4. 3006849Superfamily d.217.1: SAND domain-like [63763] (2 families) (S)
  5. 3006861Family d.217.1.2: SMAD4-binding domain of oncoprotein Ski [82611] (1 protein)
    automatically mapped to Pfam PF08782
  6. 3006862Protein SMAD4-binding domain of oncoprotein Ski [82612] (1 species)
  7. 3006863Species Human (Homo sapiens) [TaxId:9606] [82613] (1 PDB entry)
  8. 3006864Domain d1mr1c1: 1mr1 C:219-312 [79420]
    Other proteins in same PDB: d1mr1a_, d1mr1b_, d1mr1c2, d1mr1d2
    complex with SMAD4 domain
    complexed with zn

Details for d1mr1c1

PDB Entry: 1mr1 (more details), 2.85 Å

PDB Description: Crystal Structure of a Smad4-Ski Complex
PDB Compounds: (C:) Ski oncogene

SCOPe Domain Sequences for d1mr1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mr1c1 d.217.1.2 (C:219-312) SMAD4-binding domain of oncoprotein Ski {Human (Homo sapiens) [TaxId: 9606]}
rvyhecfgkckgllvpelysspsaaciqcldcrlmypphkfvvhshkalenrtchwgfds
anwrayillsqdytgkeeqarlgrclddvkekfd

SCOPe Domain Coordinates for d1mr1c1:

Click to download the PDB-style file with coordinates for d1mr1c1.
(The format of our PDB-style files is described here.)

Timeline for d1mr1c1: