Lineage for d1mqvb_ (1mqv B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699788Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2699789Protein Cytochrome c' [47180] (9 species)
  7. 2699831Species Rhodopseudomonas palustris [TaxId:1076] [47187] (2 PDB entries)
  8. 2699833Domain d1mqvb_: 1mqv B: [79416]
    complexed with hec; mutant

Details for d1mqvb_

PDB Entry: 1mqv (more details), 1.78 Å

PDB Description: crystal structure of the q1a/f32w/w72f mutant of rhodopseudomonas palustris cytochrome c' (prime) expressed in e. coli
PDB Compounds: (B:) cytochrome c'

SCOPe Domain Sequences for d1mqvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mqvb_ a.24.3.2 (B:) Cytochrome c' {Rhodopseudomonas palustris [TaxId: 1076]}
atdviaqrkailkqmgeatkpiaamlkgeakwdqavvqkslaaiaddskklpalfpadsk
tggdtaalpkifedkakfddlfaklaaaataaqgtikdeaslkaniggvlgnckschddf
rak

SCOPe Domain Coordinates for d1mqvb_:

Click to download the PDB-style file with coordinates for d1mqvb_.
(The format of our PDB-style files is described here.)

Timeline for d1mqvb_: