Lineage for d1mq7a_ (1mq7 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139618Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1139747Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1139748Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1139800Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 1139852Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)
  8. 1139864Domain d1mq7a_: 1mq7 A: [79404]
    structural genomics
    CASP5
    complexed with trs

Details for d1mq7a_

PDB Entry: 1mq7 (more details), 1.95 Å

PDB Description: crystal structure of dutpase from mycobacterium tuberculosis (rv2697c)
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1mq7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mq7a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv
hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel
velvevssfdeagl

SCOPe Domain Coordinates for d1mq7a_:

Click to download the PDB-style file with coordinates for d1mq7a_.
(The format of our PDB-style files is described here.)

Timeline for d1mq7a_: