SCOPe 2.07: Domain d1mped_: 1mpe D:

Lineage for d1mped_ (1mpe D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries)

8. Domain d1mped_: 1mpe D: [79386]
   NMR structure of the intertwined tetramer resulted from a core mutation
   mutant

Details for d1mped_

PDB Entry: 1mpe

PDB Description: ensemble of 20 structures of the tetrameric mutant of the b1 domain of streptococcal protein g

PDB Compounds: (D:) immunoglobulin g binding protein g

SCOPe Domain Sequences for d1mped_:

Sequence; same for both SEQRES and ATOM records:

>d1mped_ d.15.7.1 (D:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte

Timeline for d1mped_:

• d1mped_ first appeared in SCOP 1.63
  
• d1mped_ appears in SCOPe 2.06
  
• d1mped_ appears in the current release, SCOPe 2.08