Lineage for d1mp4a_ (1mp4 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 248321Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 248322Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) (S)
  5. 248397Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (2 protein domains)
  6. 248402Protein RmlA (RfbA) [53465] (3 species)
  7. 248469Species Salmonella enterica [TaxId:28901] [64135] (5 PDB entries)
  8. 248478Domain d1mp4a_: 1mp4 A: [79376]

Details for d1mp4a_

PDB Entry: 1mp4 (more details), 2.2 Å

PDB Description: w224h variant of s. enterica rmla

SCOP Domain Sequences for d1mp4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mp4a_ c.68.1.6 (A:) RmlA (RfbA) {Salmonella enterica}
mktrkgiilaggsgtrlypvtmavsqqllpiydkpmiyyplstlmlagirdiliistpqd
tprfqqllgdgsqwglnlqykvqpspdglaqafiigeefighddcalvlgdnifyghdlp
klmeaavnkesgatvfayhvndperygvvefdqagtavsleekplqpksnyavtglyfyd
nsvvemaknlkpsargeleitdinriymeqgrlsvammgrgyahldtgthqslieasnfi
atieerqglkvscpeeiafrknfinaqqvielagplskndygkyllkmv

SCOP Domain Coordinates for d1mp4a_:

Click to download the PDB-style file with coordinates for d1mp4a_.
(The format of our PDB-style files is described here.)

Timeline for d1mp4a_: