Lineage for d1mp0a2 (1mp0 A:163-338)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 307889Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (8 proteins)
    N-terminal all-beta domain defines family
  6. 307901Protein Alcohol dehydrogenase [51737] (6 species)
  7. 307981Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (18 PDB entries)
  8. 307988Domain d1mp0a2: 1mp0 A:163-338 [79371]
    Other proteins in same PDB: d1mp0a1, d1mp0b1

Details for d1mp0a2

PDB Entry: 1mp0 (more details), 2.2 Å

PDB Description: Binary Complex of Human Glutathione-Dependent Formaldehyde Dehydrogenase with NAD(H)

SCOP Domain Sequences for d1mp0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mp0a2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
apldkvcllgcgistgygaavntaklepgsvcavfglggvglavimgckvagasriigvd
inkdkfarakefgatecinpqdfskpiqevliemtdggvdysfecignvkvmraaleach
kgwgvsvvvgvaasgeeiatrpfqlvtgrtwkgtafggwksvesvpklvseymskk

SCOP Domain Coordinates for d1mp0a2:

Click to download the PDB-style file with coordinates for d1mp0a2.
(The format of our PDB-style files is described here.)

Timeline for d1mp0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mp0a1