SCOPe 2.05: Domain d1mozb_: 1moz B:

Lineage for d1mozb_ (1moz B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId:4932] [82402] (1 PDB entry)

8. Domain d1mozb_: 1moz B: [79369]
   complexed with gdp

Details for d1mozb_

PDB Entry: 1moz, 3.17 Å

PDB Description: adp-ribosylation factor-like 1 (arl1) from saccharomyces cerevisiae

PDB Compounds: (B:) ADP-ribosylation factor-like protein 1

SCOPe Domain Sequences for d1mozb_:

Sequence, based on SEQRES records:

>d1mozb_ c.37.1.8 (B:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}
gnifssmfdklwgsnkelrililgldgagkttilyrlqigevvttkptigfnvetlsykn
lklnvwdlggqtsirpywrcyyadtaavifvvdstdkdrmstaskelhlmlqeeelqdaa
llvfankqdqpgalsasevskelnlvelkdrswsivassaikgegitegldwlidvikee
ql

Sequence, based on observed residues (ATOM records):

>d1mozb_ c.37.1.8 (B:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}
gnifssmfdklwgsnkelrililgldgagkttilyrlqigevvttkptigfnvetlsykn
lklnvwdlgirpywrcyyadtaavifvvdstdkdrmstaskelhlmlqeeelqdaallvf
ankqdqpgalsasevskelnlvelkdrswsivassaikgegitegldwlidvikeeql

Timeline for d1mozb_:

• d1mozb_ first appeared in SCOP 1.63
  
• d1mozb_ appears in SCOPe 2.04
  
• d1mozb_ appears in SCOPe 2.06
  
• d1mozb_ appears in the current release, SCOPe 2.08