Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (15 species) |
Species Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId:4932] [82402] (1 PDB entry) |
Domain d1mozb_: 1moz B: [79369] complexed with gdp |
PDB Entry: 1moz (more details), 3.17 Å
SCOPe Domain Sequences for d1mozb_:
Sequence, based on SEQRES records: (download)
>d1mozb_ c.37.1.8 (B:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} gnifssmfdklwgsnkelrililgldgagkttilyrlqigevvttkptigfnvetlsykn lklnvwdlggqtsirpywrcyyadtaavifvvdstdkdrmstaskelhlmlqeeelqdaa llvfankqdqpgalsasevskelnlvelkdrswsivassaikgegitegldwlidvikee ql
>d1mozb_ c.37.1.8 (B:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} gnifssmfdklwgsnkelrililgldgagkttilyrlqigevvttkptigfnvetlsykn lklnvwdlgirpywrcyyadtaavifvvdstdkdrmstaskelhlmlqeeelqdaallvf ankqdqpgalsasevskelnlvelkdrswsivassaikgegitegldwlidvikeeql
Timeline for d1mozb_: