SCOPe 2.07: Domain d1mowg2: 1mow G:1007-1098

Lineage for d1mowg2 (1mow G:1007-1098)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (3 families)

5. Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
   contains two extra helices in the C-terminal extension

6. Protein DNA endonuclease I-dmoI [55612] (1 species)
   duplication: contains tandem repeat of this fold

7. Species Desulfurococcus mobilis [TaxId:2274] [55613] (2 PDB entries)

8. Domain d1mowg2: 1mow G:1007-1098 [79365]
   Other proteins in same PDB: d1mowa1, d1mowd1, d1mowg1, d1mowj1
   chimera of N-domain with I-CreI
   protein/DNA complex; complexed with gol, mg, so4

Details for d1mowg2

PDB Entry: 1mow, 2.4 Å

PDB Description: e-drei

PDB Compounds: (G:) chimera of homing endonuclease I-DmoI and DNA endonuclease I-CreI

SCOPe Domain Sequences for d1mowg2:

Sequence, based on SEQRES records:

>d1mowg2 d.95.2.1 (G:1007-1098) DNA endonuclease I-dmoI {Desulfurococcus mobilis [TaxId: 2274]}
vsgisayllgliwgdgglyklkykgnrseyrvvitqksenlikqfiaprmqflidelnvk
skiqivkgdtryelrvsskklyyyfanmleri

Sequence, based on observed residues (ATOM records):

>d1mowg2 d.95.2.1 (G:1007-1098) DNA endonuclease I-dmoI {Desulfurococcus mobilis [TaxId: 2274]}
vsgisayllgliwgdgglyklnrseyrvvitqksenlikqfiaprmqflidelnvkskiq
ivkgdtryelrvsskklyyyfanmleri

Timeline for d1mowg2:

• d1mowg2 first appeared in SCOP 1.63
  
• d1mowg2 appears in SCOPe 2.06
  
• d1mowg2 appears in the current release, SCOPe 2.08